Introduction
SH2PepInt has been developed to predict binding partners of 51 human
SH2 domains. Peptides are restrained to 7 amino acids length,
i.e. -2 to +4 amino acids around the pTyr position. Depending on
the user requirement it uses
PhosphoSitePlus
and
Gene Ontology
databases for predicting highly reliable SH2-peptide interactions.
When using SH2PepInt please cite :
- Kousik Kundu, Martin Mann, Fabrizio Costa, and Rolf Backofen
MoDPepInt: An interactive webserver for prediction of modular domain-peptide interactions
Bioinformatics, 30(18), pp. 2668–2669, 2014 - Kousik Kundu, Fabrizio Costa, Michael Huber, Michael Reth, and Rolf Backofen
Semi-Supervised Prediction of SH2-Peptide Interactions from Imbalanced High-Throughput Data
PLoS One, 8(5), pp. e62732, 2013.
Results are computed with SH2PepInt version 1.0.0
Overview
The following parameters are used to control the execution of SH2PepInt
Furthermore, additional information is available
Input Parameters
Protein/Peptide FASTA
PDZPepInt accepts input in form of a multiple FASTA file.
An example looks like this:
Input can be given either as direct text input or uploading a file.
Note: Input size is limited to restrict computation time and memory requirements.
>EbbB1 MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALA >ErbB2 MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNL ELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNG >ErbB3 MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVM >ErbB4 MKPATGLWVWVSLLVAAGTVQPSDSQSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVM GNLEITSIEHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIF
Input can be given either as direct text input or uploading a file.
Note: Input size is limited to restrict computation time and memory requirements.
The parameter constraints are: The input has to be in valid FASTA format. The number of sequences has to be at least 0 and at most 500. Sequence lengths have to be in the range 1-5000. The allowed sequence alphabet is 'GPAVLIMCFYWHKRQNEDST'. Either FASTA input or a UniProt ID list have to be provided. In case an enabled filter requires UniProt IDs: Each FASTA sequence header/name has to be just a valid UniProt ID or a valid UniProt FASTA header.
Defaults to ()
Defaults to ()
Protein UniProt IDs
Instead of feeding directly protein sequences, you can provide
UniProt IDs of the targeted proteins as an input.
In this case, the protein sequence will be automatically
downloaded from the UniProt database. Multi UniProt IDs
separated by below mentioned separators are also accepted.
An example looks like this:
P00533, P04626, P21860
The parameter constraints are: Has to be a list of 0-500 UniProt IDs that are separated by ([,\.;: \t\n]|\r\n). Access to the UniProt database is needed. The value has to match against the regular expression '^[^;'"]*$'.
Defaults to ()
Defaults to ()
SH2 Domains
List of all SH2 protein domains available for an interaction screening.
The parameter constraints are: The value has to match against the regular expression '^[^;'"]*$'. Only protein domains from the following list are allowed : ABL1, ABL2, APS, BCAR3, BLK, BMX, BRDG1, BTK, CRKL, CRK, CTEN, E105251, E109111, E185634, EAT2, FER, FES, FGR, FRK, GRAP2, GRB10, GRB14, GRB2, HCK, INPPL1, ITK, LCK, LCP2, LYN, MATK, MIST, NCK1, NCK2, PTK6, SH2B, SH2D1A, SH2D2A, SH2D3C, SHC1, SHC3, SOCS2, SOCS5, SRC, TEC, TENC1, TENS1, TNS, TXK, VAV1, VAV2, YES1.
Defaults to ()
Defaults to ()
Filters
Phosphotyrosine (pY) (needs UniProt IDs)
This filter has been implemented using the annotated information
in the
PhosphoSitePlus
database; in this way we have selected
only those phosphotyrosine peptides whose phosphorylation has
been experimentally verified. At the moment of the analysis
(January 2013) the PhosphoSitePlus database contained 30,228
phosphorylation sites from 10,688 human proteins. We have
ignored those peptides that were not present in the UniProtKB/
Swiss-Prot database obtaining finally 27,481 phosphorylation
peptides out of 9621 proteins. This filter needs UniProt IDs
of the query proteins: within FASTA provide either ONLY the UniProt ID within
the FASTA header OR use the header encoding from the UniProt
database; alternatively just provide the UniProt IDs for an
automated download of the query sequences.
The parameter constraints are: Input value has to be parsable as Boolean.
Defaults to (false)
Defaults to (false)
Cellular localization (needs UniProt IDs)
This filter was implemented considering the terms relative to
the sub-cellular localization hierarchy in the controlled
vocabulary of the
Gene Ontology database
(January, 2013). In
case of multiple cellular locations (e.g. GRB2 protein can be
found in nucleus, cytoplasm, endosome and golgi apparatus) we
consider a peptide viable for interaction if it shares at least
one of the terms with the domain. This filter is not applicable
for the domains without annotated sub-cellular localizations
(such as SHD/E105251). UniProt IDs of the query proteins are
mandatory for using this filter: within FASTA provide either ONLY the UniProt ID within
the FASTA header OR use the header encoding from the UniProt
database; alternatively just provide the UniProt IDs for an
automated download of the query sequences.
The parameter constraints are: Input value has to be parsable as Boolean.
Defaults to (false)
Defaults to (false)
Output Description
The output table summarizes all predicted protein-domain interactions.
Detailed descriptions:
Detailed descriptions:
- 1. Input sequence id
- 2. Binding region in the protein
- 3. Binding sequence
- 4. Binding domain/s with the protein
Input Examples
SH2 interactions
This is an example for the interaction prediction of human SH2
domains from GRB2, CRK and CRKL proteins with the target proteins ERBB1, ERBB2 and
ERBB3.
The example's result can be directly accessed here
Frequently Asked Questions
If your question is not listed, please send it to us!
Is it possible to train a SH2 prediction model with my own data?
In case you want to use your own data to make a dedicated
SH2-prediction model, please
contact us.
List of Changes
- 3.2.0 : SH2PepInt v1.0.0 online
