Introduction
PDZPepInt is a cluster based prediction tool to predict binding
peptides of PDZ domains in human, mouse, fly and worm. Total 43
built-in models that cover 226 PDZ domains across the species are
available. Peptides are represented as 5 C-terminal sequences of
binding proteins. Depending on the user requirement Gene Ontology
database can be used for getting reliable interactions. Additionally,
it will also consider the C-terminal peptides that are intrinsically
unstructured for getting high confidence interactions.
When using PDZPepInt please cite :
- Kousik Kundu, Martin Mann, Fabrizio Costa, and Rolf Backofen
MoDPepInt: An interactive webserver for prediction of modular domain-peptide interactions
Bioinformatics, 30(18), pp. 2668–2669, 2014 - Kousik Kundu and Rolf Backofen
Cluster based prediction of PDZ-peptide interactions
BMC Genomics, 15 Suppl 1 pp. S5, 2014.
Results are computed with PDZPepInt version 1.0.0
Overview
The following parameters are used to control the execution of PDZPepInt
Furthermore, additional information is available
Input Parameters
Protein/Peptide FASTA
PDZPepInt accepts input in form of a multiple FASTA file.
An example looks like this:
Input can be given either as direct text input or uploading a file.
Note: Input size is limited to restrict computation time and memory requirements.
>SCN5A MANFLLPRGTSSFRRFTRESLAAIEKRMAEKQARGSTTLQESREGLPEEEAPRPQLDLQA SKKLPDLYGNPPQELIGEPLEDLDPFYSTQKTFIVLNKGKTIFRFSATNALYVLSPFHPI >Sema4c MAPHWAVWLLAAGLWGLGIGAEMWWNLVPRKTVSSGELVTVVRRFSQTGIQDFLTLTLTE HSGLLYVGAREALFAFSVEALELQGAISWEAPAEKKIECTQKGKSNQTECFNFIRFLQPY >Fas2 MGELPPNSVGVFLALLLCSCSLIELTRAQSPILEIYPKQEVQRKPVGKPLILTCRPTVPE PSLVADLQWKDNRNNTILPKPNGRNQPPMYTETLPGESLALMITSLSVEMGGKYYCTASY
Input can be given either as direct text input or uploading a file.
Note: Input size is limited to restrict computation time and memory requirements.
The parameter constraints are: The input has to be in valid FASTA format. The number of sequences has to be at least 0 and at most 500. Sequence lengths have to be in the range 1-5000. The allowed sequence alphabet is 'GPAVLIMCFYWHKRQNEDST'. Either FASTA input or a UniProt ID list have to be provided. In case an enabled filter requires UniProt IDs: Each FASTA sequence header/name has to be just a valid UniProt ID or a valid UniProt FASTA header.
Defaults to ()
Defaults to ()
Protein UniProt IDs
Instead of feeding directly protein sequences, you can provide
UniProt IDs of the targeted proteins as an input.
In this case, the protein sequence will be automatically
downloaded from the UniProt database. Multi UniProt IDs
separated by below mentioned separators are also accepted.
An example looks like this:
Q14524, Q64151, P34082
The parameter constraints are: Has to be a list of 0-500 UniProt IDs that are separated by ([,\.;: \t\n]|\r\n). Access to the UniProt database is needed. The value has to match against the regular expression '^[^;'"]*$'.
Defaults to ()
Defaults to ()
PDZ Domains
List of all PDZ protein domains available for an interaction screening.
The parameter constraints are: The value has to match against the regular expression '^[^;'"]*$'. Only protein domains from the following list are allowed : AFAD_Human, AFAD_Mouse, APBA1-1_Human, APBA1-1_Mouse, APBA2-1_Human, APBA2-1_Mouse, APBA3-1_Human, APBA3-1_Mouse, CSKP_Drome, CSKP_Human, CSKP_Mouse, CYTIP_Human, CYTIP_Mouse, DLG1-1_Drome, DLG1-1_Human, DLG1-1_Mouse, DLG1-2_Drome, DLG1-2_Human, DLG1-2_Mouse, DLG1-3_Drome, DLG1-3_Human, DLG1-3_Mouse, DLG2-1_Human, DLG2-1_Mouse, DLG2-2_Human, DLG2-2_Mouse, DLG2-3_Human, DLG2-3_Mouse, DLG3-1_Human, DLG3-1_Mouse, DLG3-2_Human, DLG3-2_Mouse, DLG3-3_Human, DLG3-3_Mouse, DLG4-1_Human, DLG4-1_Mouse, DLG4-2_Human, DLG4-2_Mouse, DLG4-3_Human, DLG4-3_Mouse, DSH_Drome, DVL1_Human, DVL1_Mouse, DVL2_Human, DVL2_Mouse, DVL3_Human, DVL3_Mouse, DVLP1_Human, EM55_Human, EM55_Mouse, FRPD2-2_Human, GIPC1_Human, GIPC1_Mouse, GIPC2_Human, GIPC2_Mouse, GIPC3_Human, GIPC3_Mouse, Gm1582-2_Mouse, GOPC_Human, GOPC_Mouse, GRASP_Human, GRASP_Mouse, HTRA1_Human, HTRA1_Mouse, HTRA2_Human, HTRA2_Mouse, HTRA3_Human, HTRA3_Mouse, INADL-10_Human, INADL-10_Mouse, INADL-1_Human, INADL-1_Mouse, INADL-2_Human, INADL-2_Mouse, INADL-3_Human, INADL-3_Mouse, INADL-5_Human, INADL-5_Mouse, INADL-6_Human, INADL-6_Mouse, INADL-8_Human, INADL-8_Mouse, INADL-9_Human, INADL-9_Mouse, LAP2_Human, LAP2_Mouse, LAP4-1_Drome, LAP4-2_Drome, LAP4-3_Drome, LDB3_Human, LDB3_Mouse, LIN10-1_Caeel, LIN2_Caeel, LIN7A_Human, LIN7A_Mouse, LIN7B_Human, LIN7B_Mouse, LIN7C_Human, LIN7C_Mouse, LNX1-1_Human, LNX1-1_Mouse, LNX2-1_Human, LNX2-1_Mouse, LRRC7_Human, LRRC7_Mouse, MAGI1-2_Human, MAGI1-2_Mouse, MAGI1-4_Mouse, MAGI1-5_Mouse, MAGI1-6_Mouse, MAGI2-2_Human, MAGI2-2_Mouse, MAGI2-4_Human, MAGI2-4_Mouse, MAGI2-5_Human, MAGI2-5_Mouse, MAGI2-6_Human, MAGI2-6_Mouse, MAGI3-1_Human, MAGI3-1_Mouse, MAGI3-2_Human, MAGI3-2_Mouse, MAGI3-4_Human, MAGI3-4_Mouse, MAGI3-5_Human, MAGI3-5_Mouse, MAGI3-6_Human, MAGI3-6_Mouse, MPDZ-10_Human, MPDZ-10_Mouse, MPDZ-11_Human, MPDZ-11_Mouse, MPDZ-12_Human, MPDZ-12_Mouse, MPDZ-13_Human, MPDZ-13_Mouse, MPDZ-1_Human, MPDZ-1_Mouse, MPDZ-2_Human, MPDZ-2_Mouse, MPDZ-3_Human, MPDZ-3_Mouse, MPDZ-5_Human, MPDZ-5_Mouse, MPDZ-7_Human, MPDZ-7_Mouse, MPDZ-9_Human, MPDZ-9_Mouse, MPP2_Human, MPP2_Mouse, MPP6_Human, MPP6_Mouse, NHRF1-1_Human, NHRF1-1_Mouse, NHRF1-2_Human, NHRF1-2_Mouse, NHRF2-1_Human, NHRF2-1_Mouse, NHRF2-2_Human, NHRF2-2_Mouse, NHRF3-1_Human, NHRF3-1_Mouse, NHRF4-3_Human, NHRF4-3_Mouse, PATJ-1_Drome, PATJ-2_Drome, PATJ-4_Drome, PDLI1_Human, PDLI1_Mouse, PDLI2_Human, PDLI2_Mouse, PDLI3_Human, PDLI3_Mouse, PDLI4_Human, PDLI4_Mouse, PDLI5_Human, PDLI5_Mouse, PDLI7_Human, PDLI7_Mouse, PDZD2-2_Human, Pdzk3-1_Mouse, PTN13-1_Human, PTN13-1_Mouse, PTN13-2_Human, PTN13-2_Mouse, PTN13-4_Human, PTN13-4_Mouse, RGS3_Human, RGS3_Mouse, SCRIB-1_Human, SCRIB-1_Mouse, SCRIB-2_Human, SCRIB-2_Mouse, SCRIB-3_Human, SCRIB-3_Mouse, SHAN1_Human, SHAN1_Mouse, SHAN2_Human, SHAN2_Mouse, SHAN3_Human, SHAN3_Mouse, SNT1_Caeel, SNTA1_Human, SNTA1_Mouse, SNTB1_Human, SNTB1_Mouse, SNTB2_Human, SNTB2_Mouse, SNTG1_Human, SNTG1_Mouse, SNTG2_Human, SNTG2_Mouse, SYJ2B_Human, SYJ2B_Mouse, ZO1-1_Human, ZO1-1_Mouse, ZO1-3_Human, ZO1-3_Mouse, ZO2-1_Human, ZO2-1_Mouse, ZO2-3_Human, ZO2-3_Mouse, ZO3-1_Human, ZO3-1_Mouse, ZO3-3_Human, ZO3-3_Mouse.
Defaults to ()
Defaults to ()
Custom PDZ Domain
PDZPepInt offers predictions also for domains that are newly developed
and/or not comprised in the original 226 PDZ domains.
The unknown domains are first aligned to the
known ones, obtaining a similarity score against each known domain,
finally the weighted combination of the predictions of each known
model is computed. Multiple query domain sequences can also be
provided.
The new domain data has to be provided in multiline FASTA format.
An example looks like this:
>New-domain TLERGNSGLGFSIAGGTDNPHILFITKIIPGGALLQDGRLRVNDSILFVNEVE VKEVTHSAAVEALREAGSIVRLYVM
The parameter constraints are: The input has to be in valid FASTA format. The number of sequences has to be at least 0 and at most 300. Sequence lengths have to be in the range 1-1000. The allowed sequence alphabet is 'GPAVLIMCFYWHKRQNEDST'.
Defaults to ()
Defaults to ()
Filters
Intrinsically unstructured/disordered region
PDZ domains have tendency to bind with intrinsically
unstructured proteins (IUPs), thus this filter has been
introduced to consider only those peptides that reside in a
disordered protein region. We used
IUPred
algorithm
(version 1.0) to calculate IUPred scores of last 5 residues
of a protein (potential binding region). The peptides having
IUPred scores more than 0.4 are considered.
The parameter constraints are: Input value has to be parsable as Boolean.
Defaults to (true)
Defaults to (true)
Cellular localization (needs UniProt IDs)
This filter was implemented considering the terms
relative to the sub-cellular localization hierarchy in the
controlled vocabulary of the
Gene Ontology database
(January,
2013). In case of multiple cellular locations we consider a
peptide viable for interaction if it shares at least one of
the terms with the domain. This filter is not applicable for
the domains without annotated sub-cellular localizations.
UniProt Ids of the query proteins are mandatory for using this
filter: within FASTA provide either ONLY the UniProt ID within
the FASTA header OR use the header encoding from the UniProt
database; alternatively just provide the UniProt IDs for an
automated download of the query sequences.
The parameter constraints are: Input value has to be parsable as Boolean.
Defaults to (false)
Defaults to (false)
Output Description
The output table summarizes all predicted protein-domain interactions.
Detailed descriptions:
Detailed descriptions:
- 1. Input sequence id
- 2. Binding region in the protein
- 3. Binding sequence
- 4. Binding domain/s with the protein
Input Examples
PDZ interactions
This is an example for the PDZ-peptide interaction
prediction. PDZ domains from different organisms bind with their
respective peptides.
The example's result can be directly accessed here
List of Changes
- 3.2.0 : PDZPepInt v1.0.0 online
