Introduction
The Meta-server has been implemented for the non-expert users. The output comprises predictions for all
available domains for SH2, SH3 and PDZ. It reports only the 5 most confident predictions for each domain.
The users are not required to set any parameters in this mode.
By default all the parameters are on except pY filter (for SH2PepInt) and Cellular localization filters
(for all three tools) since they need UniProt IDs of the query proteins.
However, the user can easily select one of the dedicated tools for the same
input to access the full prediction results and have a finer control over its parametric setting.
When using MetaServer please cite :
- Kousik Kundu, Martin Mann, Fabrizio Costa, and Rolf Backofen
MoDPepInt: An interactive webserver for prediction of modular domain-peptide interactions
Bioinformatics, 30(18), pp. 2668–2669, 2014 - Kousik Kundu, Fabrizio Costa, Michael Huber, Michael Reth, and Rolf Backofen
Semi-Supervised Prediction of SH2-Peptide Interactions from Imbalanced High-Throughput Data
PLoS One, 8(5), pp. e62732, 2013. - Kousik Kundu, Fabrizio Costa, and Rolf Backofen
A graph kernel approach for alignment-free domain-peptide interaction prediction with an application to human SH3 domains
Bioinformatics, 29(13), pp. i335-i343, 2013. - Kousik Kundu and Rolf Backofen
Cluster based prediction of PDZ-peptide interactions
BMC Genomics, 15 Suppl 1 pp. S5, 2014.
Results are computed with MetaServer version 1.0.0
Overview
The following parameters are used to control the execution of MetaServer
Furthermore, additional information is available
Input Parameters
Protein/Peptide FASTA
PDZPepInt accepts input in form of a multiple FASTA file.
An example looks like this:
Input can be given either as direct text input or uploading a file.
Note: Input size is limited to restrict computation time and memory requirements.
>EbbB1 MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALA >ErbB2 MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNL ELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNG >ErbB3 MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVM >ErbB4 MKPATGLWVWVSLLVAAGTVQPSDSQSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVM GNLEITSIEHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIF
Input can be given either as direct text input or uploading a file.
Note: Input size is limited to restrict computation time and memory requirements.
The parameter constraints are: The input has to be in valid FASTA format. The number of sequences has to be at least 0 and at most 500. Sequence lengths have to be in the range 1-5000. The allowed sequence alphabet is 'GPAVLIMCFYWHKRQNEDST'. Either FASTA input or a UniProt ID list have to be provided. In case an enabled filter requires UniProt IDs: Each FASTA sequence header/name has to be just a valid UniProt ID or a valid UniProt FASTA header.
Defaults to ()
Defaults to ()
Protein UniProt IDs
Instead of feeding directly protein sequences, you can provide
UniProt IDs of the targeted proteins as an input.
In this case, the protein sequence will be automatically
downloaded from the UniProt database. Multi UniProt IDs
separated by below mentioned separators are also accepted.
An example looks like this:
P00533, P04626, P21860
The parameter constraints are: Has to be a list of 0-500 UniProt IDs that are separated by ([,\.;: \t\n]|\r\n). Access to the UniProt database is needed. The value has to match against the regular expression '^[^;'"]*$'.
Defaults to ()
Defaults to ()
Output Description
The output tables summarize all predicted protein-domain interactions.
Detailed descriptions:
Note: predictions cover all domains available independent of the organism of interest. In order to select for a specific organism, please relate to the according dedicated tool.
Detailed descriptions:
- 1. Input sequence id
- 2. Binding region in the protein
- 3. Binding sequence
- 4. Binding domain/s with the protein
Note: predictions cover all domains available independent of the organism of interest. In order to select for a specific organism, please relate to the according dedicated tool.
Input Examples
general example
This is an example for the interaction prediction of human SH2, SH3 and PDZ domains with two sample target proteins.
The example's result can be directly accessed here
List of Changes
- 3.3.0 : MetaServer v1.0.0 online
